PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0150s0013.6.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 384aa    MW: 42232.6 Da    PI: 7.5018
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0150s0013.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.81.2e-333488155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Kalax.0150s0013.6.p 34 KPRLRWTVELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 88
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8013191IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-323189IPR009057Homeodomain-like
SuperFamilySSF466891.97E-163389IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-233489IPR006447Myb domain, plants
PfamPF002492.9E-83686IPR001005SANT/Myb domain
PfamPF143793.8E-21127166IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MFHSKKPSSM NNSPHERAMC VQGDSGLVLT TDPKPRLRWT VELHERFVDA VAQLGGPDKA  60
TPKTIMRVMG VKGLTLYHLK SHLQKFRLGK QPHKEFNEHS LKDVSALELQ RSNTSSSGMM  120
GRNMNEMQLE VQRRLHEQLE VQRHLQLRIE AQGKYMQAIL EKACQTLAGE NNHNMASGSS  180
SYNNMKAGIG NNQGVGGQHH QDLDAIKDFA SLGFPSLLDL SIYGQAAAGG DQIDLHQSNF  240
DSNDTDNSRP PSMDVFIHDP NTNDDAICLG NPKKRPSPYI SSSGNGKGPL LWSDDLRLQD  300
LGTATTQSCH DIQIGPPPST SPAMEETLFE TKPMSLNGDP MMGEKAIKLE RPSPRRVPHV  360
SSVDRMMNPV MSMSQGRSSS PFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008226001.11e-149PREDICTED: myb family transcription factor APL
RefseqXP_015889545.11e-149PREDICTED: myb family transcription factor APL isoform X3
SwissprotQ9SAK51e-120APL_ARATH; Myb family transcription factor APL
TrEMBLA5ASR11e-149A5ASR1_VITVI; Putative uncharacterized protein
STRINGVIT_19s0085g00890.t011e-148(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-120G2-like family protein